Recombinant Escherichia coli Colicin-E5 (col), partial

Produktübersicht

• Artikelname: Recombinant Escherichia coli Colicin-E5 (col), partial
• Artikelnummer: CSB-CF323819ENL1
• Hersteller Artikelnummer: CSB-CF323819ENL1
• Alternativnummer: CSB-CF323819ENL1-100, CSB-CF323819ENL1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 24.8 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P18000
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 74-180aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ