Recombinant Culex quinquefasciatus Odorant receptor (6031407)

Artikelnummer: CSB-CF3304DZM
Artikelname: Recombinant Culex quinquefasciatus Odorant receptor (6031407)
Artikelnummer: CSB-CF3304DZM
Hersteller Artikelnummer: CSB-CF3304DZM
Alternativnummer: CSB-CF3304DZM-100, CSB-CF3304DZM-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: /,CSB-PR2024
Molekulargewicht: 47.3 kDa
Tag: N-terminal 10xHis-tagged
UniProt: B0W0I1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 1-393aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKFYELREPMAAVPFILRVLRFSGLLGCPRGLLRFGLSFLGPWLVIGLPKLICGFGSDLGLNVRGYAEVLFMCNIDVRMLVFFWHRRKLAEFVEIVQRAFDKVSILSSDSSMYKMILKSNQMMDKSAKSYVLYTLGTSGVFLVLPALQSCGIYFMNHGNDTVVPKFVTATAHEESGWDVDENIVYYFIHVMLITPMHLLLGLRFATIDTMIFCGVRSTILLFRLVSAKLEKLHKFSGSTLREQFLDVVNLHVDA