Recombinant Measles virus Hemagglutinin glycoprotein (H)

Artikelnummer: CSB-CF334056MCR
Artikelname: Recombinant Measles virus Hemagglutinin glycoprotein (H)
Artikelnummer: CSB-CF334056MCR
Hersteller Artikelnummer: CSB-CF334056MCR
Alternativnummer: CSB-CF334056MCR-100, CSB-CF334056MCR-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 75.4 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P35971
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 1-617aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRLHRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISDKIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLETRTTNQFLAVSKGNCSGPTTIRGQFSNMSLSLLDLYLGRGYNVSSIVTMTSQGMYGGTYLVEKPNLSSKRSELSQLSMYRV