Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin Preis auf Anfrage

Artikelnummer: CSB-EP307045AET
Artikelname: Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin Preis auf Anfrage
Artikelnummer: CSB-EP307045AET
Hersteller Artikelnummer: CSB-EP307045AET
Alternativnummer: CSB-EP307045AET-1,CSB-EP307045AET-100,CSB-EP307045AET-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Fibrinogen-clotting enzyme (Snake venom serine protease) (SVSP) (Venombin B)
Molekulargewicht: 32.4 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P82981
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-234aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.