Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI (BuXI) Preis auf Anfrage

Artikelnummer: CSB-EP307110BFM
Artikelname: Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI (BuXI) Preis auf Anfrage
Artikelnummer: CSB-EP307110BFM
Hersteller Artikelnummer: CSB-EP307110BFM
Alternativnummer: CSB-EP307110BFM-1,CSB-EP307110BFM-100,CSB-EP307110BFM-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Factor Xa inhibitor BuXI
Molekulargewicht: 23.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P83594
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-172aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.