Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial
Artikelnummer:
CSB-EP333180HFD
- Bilder (0)
| Artikelname: | Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial |
| Artikelnummer: | CSB-EP333180HFD |
| Hersteller Artikelnummer: | CSB-EP333180HFD |
| Alternativnummer: | CSB-EP333180HFD-1, CSB-EP333180HFD-100, CSB-EP333180HFD-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC |
| Molekulargewicht: | 30.7 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P26664 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 192-325aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN |
Produktgarantie und fachkundiger Support
