Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB)

Produktübersicht

• Artikelname: Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB)
• Artikelnummer: CSB-EP359247ENVA1
• Hersteller Artikelnummer: CSB-EP359247ENVa1
• Alternativnummer: CSB-EP359247ENVA1-1, CSB-EP359247ENVA1-100, CSB-EP359247ENVA1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 3-oxoacyl-[acyl-carrier-protein] synthase I Beta-ketoacyl-ACP synthase I,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 49.3 kDa
• Tag: N-terminal 6xHis-tagged and C-terminal Myc-tagged
• UniProt: P0A953
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-406aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIY