Recombinant Salmonella enteritidis Cold shock protein CspA (cspA)

Produktübersicht

• Artikelname: Recombinant Salmonella enteritidis Cold shock protein CspA (cspA)
• Artikelnummer: CSB-EP359368SBG
• Hersteller Artikelnummer: CSB-EP359368SBG
• Alternativnummer: CSB-EP359368SBG-1, CSB-EP359368SBG-100, CSB-EP359368SBG-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 7.4 kDa cold shock protein CS7.4

Produkteigenschaften

• Molekulargewicht: 14.7 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: P0A9Y5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 2-70aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL