Recombinant Escherichia coli Thioredoxin-1 (trxA)

Produktübersicht

• Artikelname: Recombinant Escherichia coli Thioredoxin-1 (trxA)
• Artikelnummer: CSB-EP359388ENV
• Hersteller Artikelnummer: CSB-EP359388ENV
• Alternativnummer: CSB-EP359388ENV-1, CSB-EP359388ENV-100, CSB-EP359388ENV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: trxA, fipA, tsnC, b3781, JW5856, Thioredoxin 1, Trx-1

Produkteigenschaften

• Molekulargewicht: 15.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P0AA25
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 2-109aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA