Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase (ideZ)

Produktübersicht

• Artikelname: Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase (ideZ)
• Artikelnummer: CSB-EP3597GOM
• Hersteller Artikelnummer: CSB-EP3597GOM
• Alternativnummer: CSB-EP3597GOM-1, CSB-EP3597GOM-100, CSB-EP3597GOM-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 37.3 kDa
• Tag: C-terminal 12xHis-tagged
• UniProt: Q0PIW1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 35-349aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DDYQRNAAEVYAKEVPHQITSVWTKGVTPLTPEQFRYNNEDVIHAPYLAHQGWYDITKVFDGKDNLLCGAATAGNMLHWWFDQNKTEIEAYLSKHPEKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQLGVMPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTTLLTARHDLKNKGLNDISTIIKQELTEGRALALSHTYANVSISHVINLWGADFNAEGNLE