Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA)

Produktübersicht

• Artikelname: Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA)
• Artikelnummer: CSB-EP360010ENV
• Hersteller Artikelnummer: CSB-EP360010ENV
• Alternativnummer: CSB-EP360010ENV-1, CSB-EP360010ENV-100, CSB-EP360010ENV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: lptA, yhbN, b3200, JW3167, Lipopolysaccharide export system protein LptA,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 33.3 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P0ADV1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 28-185aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN