Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1)

Produktübersicht

• Artikelname: Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1)
• Artikelnummer: CSB-EP360492SVG
• Hersteller Artikelnummer: CSB-EP360492SVG
• Alternativnummer: CSB-EP360492SVG-1, CSB-EP360492SVG-100, CSB-EP360492SVG-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1

Produkteigenschaften

• Molekulargewicht: 39.2 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P01123
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-206aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC