Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB)

Produktübersicht

• Artikelname: Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB)
• Artikelnummer: CSB-EP360704VEX
• Hersteller Artikelnummer: CSB-EP360704VEX
• Alternativnummer: CSB-EP360704VEX-1, CSB-EP360704VEX-100, CSB-EP360704VEX-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cholera enterotoxin B chain Cholera enterotoxin gamma chain Choleragenoid,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 15.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P01556
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 22-124aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN