Recombinant Human Interferon alpha-2 (IFNA2)

Produktübersicht

• Artikelname: Recombinant Human Interferon alpha-2 (IFNA2)
• Artikelnummer: CSB-EP360706HU
• Hersteller Artikelnummer: CSB-EP360706HU
• Alternativnummer: CSB-EP360706HU-1, CSB-EP360706HU-100, CSB-EP360706HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Interferon alpha-A ,LeIF A

Produkteigenschaften

• Molekulargewicht: 46.2 kDa
• Tag: N-terminal GST-tagged
• UniProt: P01563
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 24-188aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE