Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)

Produktübersicht

• Artikelname: Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)
• Artikelnummer: CSB-EP360812MO
• Hersteller Artikelnummer: CSB-EP360812MO
• Alternativnummer: CSB-EP360812MO-1, CSB-EP360812MO-100, CSB-EP360812MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chain

Produkteigenschaften

• Molekulargewicht: 42.7 kDa
• Tag: N-terminal GST-tagged
• UniProt: P02089
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 2-147aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH