Recombinant Chicken Riboflavin-binding protein, partial

Produktübersicht

• Artikelname: Recombinant Chicken Riboflavin-binding protein, partial
• Artikelnummer: CSB-EP360879CH
• Hersteller Artikelnummer: CSB-EP360879CH
• Alternativnummer: CSB-EP360879CH-1, CSB-EP360879CH-100, CSB-EP360879CH-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: , Riboflavin-binding protein, RBP) [Cleaved into: Riboflavin-binding protein, plasma form, Riboflavin-binding protein, yolk major form, Riboflavin-binding protein, yolk minor form]

Produkteigenschaften

• Molekulargewicht: 27.8 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P02752
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 18-225aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK