Recombinant BK polyomavirus Major capsid protein VP1

Produktübersicht

• Artikelname: Recombinant BK polyomavirus Major capsid protein VP1
• Artikelnummer: CSB-EP360953BGY
• Hersteller Artikelnummer: CSB-EP360953BGY
• Alternativnummer: CSB-EP360953BGY-1, CSB-EP360953BGY-100, CSB-EP360953BGY-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Major structural protein VP1

Produkteigenschaften

• Molekulargewicht: 60.1 kDa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• UniProt: P03088
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-362aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAPTKRKGECPGAAPKKPKEPVQVPKLLIKGGVEVLEVKTGVDAITEVECFLNPEMGDPDENLRGFSLKLSAENDFSSDSPERKMLPCYSTARIPLPNLNEDLTCGNLLMWEAVTVQTEVIGITSMLNLHAGSQKVHEHGGGKPIQGSNFHFFAVGGEPLEMQGVLMNYRSKYPDGTITPKNPTAQSQVMNTDHKAYLDKNNAYPVECWVPDPSRNENARYFGTFTGGENVPPVLHVTNTATTVLLDEQGVGPL