Recombinant Epstein-Barr virus Triplex capsid protein 1 (TRX1)

Produktübersicht

• Artikelname: Recombinant Epstein-Barr virus Triplex capsid protein 1 (TRX1)
• Artikelnummer: CSB-EP360982EFA
• Hersteller Artikelnummer: CSB-EP360982EFA
• Alternativnummer: CSB-EP360982EFA-1, CSB-EP360982EFA-100, CSB-EP360982EFA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 46.6 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: P03187
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-364aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKVQGSVDRRRLQRRIAGLLPPPARRLNISRGSEFTRDVRGLVEEHAQASSLSAAAVWRAGLLAPGEVAVAGGGSGGGSFSWSGWRPPVFGDFLIHASSFNNAEATGTPLFQFKQSDPFSGVDAVFTPLSLFILMNHGRGVAARVEAGGGLTRMANLLYDSPATLADLVPDFGRLVADRRFHNFITPVGPLVENIKSTYLNKITTVVHGPVVSKAIPRSTVKVTVPQEAFVDLDAWLSGGAGGGGGVCFVGGLG