Recombinant Sindbis virus Non-structural polyprotein, partial
Artikelnummer:
CSB-EP361019SHZ
- Bilder (0)
| Artikelname: | Recombinant Sindbis virus Non-structural polyprotein, partial |
| Artikelnummer: | CSB-EP361019SHZ |
| Hersteller Artikelnummer: | CSB-EP361019SHZ |
| Alternativnummer: | CSB-EP361019SHZ-1, CSB-EP361019SHZ-100, CSB-EP361019SHZ-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Non-structural polyprotein)(p270 nonstructural polyprotein)(Non-structural protein 4)(nsP4),CSB-PR2024 |
| Molekulargewicht: | 60.4 kDa |
| Tag: | Tag-Free |
| UniProt: | P03317 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1348-1896aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | APSYRTKRENIADCQEEAVVNAANPLGRPGEGVCRAIYKRWPTSFTDSATETGTARMTVCLGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGIYAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEIDDELVWIHPDSCLKGRKGFSTTKGKLYSYFEGTKFHQAAKDMAEIKVLFPNDQESNEQLCAYILGETMEAIREKCPVDHNPS |
Produktgarantie und fachkundiger Support
