Recombinant Escherichia phage lambda Capsid decoration protein (D), partial
Artikelnummer:
CSB-EP361132FSF1E3
- Bilder (0)
| Artikelname: | Recombinant Escherichia phage lambda Capsid decoration protein (D), partial |
| Artikelnummer: | CSB-EP361132FSF1E3 |
| Hersteller Artikelnummer: | CSB-EP361132FSF1e3 |
| Alternativnummer: | CSB-EP361132FSF1E3-1, CSB-EP361132FSF1E3-100, CSB-EP361132FSF1E3-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Auxiliary protein D Gene product D Major capsid protein D |
| Molekulargewicht: | 21.2 kDa |
| Tag: | N-terminal 6xHis-KSI-tagged |
| UniProt: | P03712 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1-56aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDG |
Produktgarantie und fachkundiger Support
