Recombinant Human papillomavirus type 11 Protein E6 (E6)

Produktübersicht

• Artikelname: Recombinant Human papillomavirus type 11 Protein E6 (E6)
• Artikelnummer: CSB-EP361193HMG
• Hersteller Artikelnummer: CSB-EP361193HMG
• Alternativnummer: CSB-EP361193HMG-1, CSB-EP361193HMG-100, CSB-EP361193HMG-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein E6

Produkteigenschaften

• Molekulargewicht: 23.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P04019
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-150aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACACCLELQGKINQYRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPLCEIEKLKHILGKARFIKLNNQWKGRCLHCWTTCMEDLLP