Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1),partial

Produktübersicht

• Artikelname: Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1),partial
• Artikelnummer: CSB-EP361230HU
• Hersteller Artikelnummer: CSB-EP361230HU
• Alternativnummer: CSB-EP361230HU-1, CSB-EP361230HU-100, CSB-EP361230HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: MHC class II antigen DRB1*1

Produkteigenschaften

• Molekulargewicht: 42.9 kDa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• UniProt: P04229
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 30-227aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK