Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX)

Produktübersicht

• Artikelname: Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX)
• Artikelnummer: CSB-EP361289EDZ
• Hersteller Artikelnummer: CSB-EP361289EDZ
• Alternativnummer: CSB-EP361289EDZ-1, CSB-EP361289EDZ-100, CSB-EP361289EDZ-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: UVSX,Recombination and repair protein

Produkteigenschaften

• Molekulargewicht: 60 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P04529
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-391aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSDLKSRLIKASTSKLTAELTASKFFNEKDVVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKKETEDALNEKVVSDMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTYETQEMFSKTVMGGGTGPMYSADTVFIIGKRQIKDGSDLQGYQFVLNVEKSRTVKEKS