Recombinant Mouse Serum amyloid A-3 protein (Saa3), partial
Artikelnummer:
CSB-EP361411MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Serum amyloid A-3 protein (Saa3), partial |
| Artikelnummer: | CSB-EP361411MO |
| Hersteller Artikelnummer: | CSB-EP361411MO |
| Alternativnummer: | CSB-EP361411MO-1, CSB-EP361411MO-100, CSB-EP361411MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Saa3, Serum amyloid A-3 protein |
| Molekulargewicht: | 15.8 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P04918 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 20-122aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY |
Produktgarantie und fachkundiger Support
