Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

Produktübersicht

• Artikelname: Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)
• Artikelnummer: CSB-EP361472ARW
• Hersteller Artikelnummer: CSB-EP361472ARW
• Alternativnummer: CSB-EP361472ARW-1, CSB-EP361472ARW-100, CSB-EP361472ARW-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ns3b,Accessory protein 3b,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 8.4 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P05138
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-64aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLNLEAIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE