Recombinant Human Uncharacterized protein C4orf3 (C4orf3), partial
Artikelnummer:
CSB-EP823892HU
- Bilder (0)
| Artikelname: | Recombinant Human Uncharacterized protein C4orf3 (C4orf3), partial |
| Artikelnummer: | CSB-EP823892HU |
| Hersteller Artikelnummer: | CSB-EP823892HU |
| Alternativnummer: | CSB-EP823892HU-1, CSB-EP823892HU-100, CSB-EP823892HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Hepatitis C virus F protein-transactivated protein 1 ,HCV F-transactivated protein 1 |
| Molekulargewicht: | 20.8 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | Q8WVX3 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1-44aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY |
Produktgarantie und fachkundiger Support
