Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial
Artikelnummer:
CSB-MP023924HU
- Bilder (0)
| Artikelname: | Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial |
| Artikelnummer: | CSB-MP023924HU |
| Hersteller Artikelnummer: | CSB-MP023924HU |
| Alternativnummer: | CSB-MP023924HU-1, CSB-MP023924HU-100, CSB-MP023924HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Serine protease 10) (PRSS10) |
| Molekulargewicht: | 47.8 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | O15393 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 106-492aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND |
Produktgarantie und fachkundiger Support
