Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial, Biotinylated
Artikelnummer:
CSB-MP023974HU1-B
- Bilder (0)
| Artikelname: | Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial, Biotinylated |
| Artikelnummer: | CSB-MP023974HU1-B |
| Hersteller Artikelnummer: | CSB-MP023974HU1-B |
| Alternativnummer: | CSB-MP023974HU1-B-1, CSB-MP023974HU1-B-100, CSB-MP023974HU1-B-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (B-cell maturation protein)(CD antigen CD269),CSB-PR2024 |
| Molekulargewicht: | 34.9 kDa |
| Tag: | C-terminal mFc-Avi-tagged |
| UniProt: | Q02223 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 1-54aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
Produktgarantie und fachkundiger Support
