Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial
Artikelnummer:
CSB-MP023991HU
- Bilder (0)
| Artikelname: | Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial |
| Artikelnummer: | CSB-MP023991HU |
| Hersteller Artikelnummer: | CSB-MP023991HU |
| Alternativnummer: | CSB-MP023991HU-1, CSB-MP023991HU-100, CSB-MP023991HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Herpes virus entry mediator ligand (HVEM-L) (Herpesvirus entry mediator ligand) (HVEML) (CD_antigen: CD258) (LIGHT) |
| Molekulargewicht: | 48.3 kDa |
| Tag: | C-terminal hFc-Myc-tagged |
| UniProt: | O43557 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 74-240aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
Produktgarantie und fachkundiger Support
