Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial, Biotinylated
• Artikelnummer: CSB-MP023997HU-B
• Hersteller Artikelnummer: CSB-MP023997HU-B
• Alternativnummer: CSB-MP023997HU-B-1, CSB-MP023997HU-B-100, CSB-MP023997HU-B-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 4-1BB ligand,4-1BBL

Produkteigenschaften

• Molekulargewicht: 50.6 kDa
• Tag: C-terminal hFc-Avi-tagged
• UniProt: P41273
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 50-254aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE