Recombinant Human T cell receptor beta constant 2 (TRBC2), partial

Produktübersicht

• Artikelname: Recombinant Human T cell receptor beta constant 2 (TRBC2), partial
• Artikelnummer: CSB-MP024292HU
• Hersteller Artikelnummer: CSB-MP024292HU
• Alternativnummer: CSB-MP024292HU-1, CSB-MP024292HU-100, CSB-MP024292HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: TCRBC2,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 43.6 kDa
• Tag: C-terminal hFc-tagged
• UniProt: A0A5B9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 1-129aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD