Recombinant Human Thymic stromal lymphopoietin (TSLP)
Artikelnummer:
CSB-MP025141HU
- Bilder (0)
| Artikelname: | Recombinant Human Thymic stromal lymphopoietin (TSLP) |
| Artikelnummer: | CSB-MP025141HU |
| Hersteller Artikelnummer: | CSB-MP025141HU |
| Alternativnummer: | CSB-MP025141HU-1, CSB-MP025141HU-100, CSB-MP025141HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN,CSB-PR2024 |
| Molekulargewicht: | 18.9 kDa |
| Tag: | N-terminal 6xHis-Myc-tagged |
| UniProt: | Q969D9 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 29-159aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Produktgarantie und fachkundiger Support
