Recombinant Mouse Ubiquitin-protein ligase E3A (Ube3a), partial
Artikelnummer:
CSB-MP025488MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Ubiquitin-protein ligase E3A (Ube3a), partial |
| Artikelnummer: | CSB-MP025488MO |
| Hersteller Artikelnummer: | CSB-MP025488MO |
| Alternativnummer: | CSB-MP025488MO-1, CSB-MP025488MO-100, CSB-MP025488MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Oncogenic protein-associated protein E6-AP |
| Molekulargewicht: | 40.9 kDa |
| Tag: | C-terminal Flag-Myc-tagged |
| UniProt: | O08759 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 542-870aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDE |
Produktgarantie und fachkundiger Support
