Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1)

Produktübersicht

• Artikelname: Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1)
• Artikelnummer: CSB-MP025965HU
• Hersteller Artikelnummer: CSB-MP025965HU
• Alternativnummer: CSB-MP025965HU-1, CSB-MP025965HU-100, CSB-MP025965HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Interferon-induced protein 53)(IFP53)(Tryptophanyl-tRNA synthetase)(TrpRS)(hWRS),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 56.7 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P23381
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 2-471aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LVPRGSRTPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGF