Recombinant Macaca mulatta Oncostatin M (OSM), partial

Produktübersicht

• Artikelname: Recombinant Macaca mulatta Oncostatin M (OSM), partial
• Artikelnummer: CSB-MP2949MOW
• Hersteller Artikelnummer: CSB-MP2949MOW
• Alternativnummer: CSB-MP2949MOW-1, CSB-MP2949MOW-100, CSB-MP2949MOW-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 29.9 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: F7GF43
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 22-252aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR