Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial

Produktübersicht

• Artikelname: Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial
• Artikelnummer: CSB-MP318280ARV
• Hersteller Artikelnummer: CSB-MP318280ARV
• Alternativnummer: CSB-MP318280ARV-1, CSB-MP318280ARV-100, CSB-MP318280ARV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: pp1ab,ORF1ab polyprotein

Produkteigenschaften

• Molekulargewicht: 26.9 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P12723
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 1-219aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ