Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

Produktübersicht

• Artikelname: Recombinant Avian infectious bronchitis virus Nucleoprotein (N)
• Artikelnummer: CSB-MP320135ARV
• Hersteller Artikelnummer: CSB-MP320135ARV
• Alternativnummer: CSB-MP320135ARV-1, CSB-MP320135ARV-100, CSB-MP320135ARV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nucleocapsid protein,NC,Protein N,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 47.2 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P12648
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 1-409aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKAKKLNSPPLKFEGSGVPDNENLKTSQQHGYWRRQARFKPSKGGRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGKSTAASSAASSRAPSREGSRGRRSGAEDDLIARAAKIIQDQQKKGARITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFG