Recombinant Porcine parvovirus Capsid protein VP1, partial
Artikelnummer:
CSB-MP323858PQB
- Bilder (0)
| Artikelname: | Recombinant Porcine parvovirus Capsid protein VP1, partial |
| Artikelnummer: | CSB-MP323858PQB |
| Hersteller Artikelnummer: | CSB-MP323858PQB |
| Alternativnummer: | CSB-MP323858PQB-1, CSB-MP323858PQB-100, CSB-MP323858PQB-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Coat protein VP1 |
| Molekulargewicht: | 26.4 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P18546 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 1-207aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MAPPAKRARGLTLPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYDKYIKSGKNPYFYFSAADEKFIKETEHAKDYGGKIGHYFFRAKRAFAPKLSETDSPTTSQQPEVRRSPRKHPGSKPPGKRPAPRHIFINLAKKKAKGTSNTNSNSMSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGE |
Produktgarantie und fachkundiger Support
