Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (G75V,T76I,SYLTPGD247-253del), partial

Produktübersicht

• Artikelname: Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (G75V,T76I,SYLTPGD247-253del), partial
• Artikelnummer: CSB-MP3324GMY(M8)
• Hersteller Artikelnummer: CSB-MP3324GMY(M8)
• Alternativnummer: CSB-MP3324GMY(M8)-1, CSB-MP3324GMY(M8)-100, CSB-MP3324GMY(M8)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2)

Produkteigenschaften

• Molekulargewicht: 37.4 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P0DTC2
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 16-318aa(G75V,T76I,SYLTPGD247-253del)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNVIKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSSSGWTAGAAAYYVGYLQPRTFL