Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial

Produktübersicht

• Artikelname: Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial
• Artikelnummer: CSB-MP333180HFD
• Hersteller Artikelnummer: CSB-MP333180HFD
• Alternativnummer: CSB-MP333180HFD-1, CSB-MP333180HFD-100, CSB-MP333180HFD-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC

Produkteigenschaften

• Molekulargewicht: 18.7 kDa
• Tag: C-terminal 6xHis-Myc-tagged
• UniProt: P26664
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 192-325aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN