Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)
Artikelnummer:
CSB-MP3388GND
- Bilder (0)
| Artikelname: | Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) |
| Artikelnummer: | CSB-MP3388GND |
| Hersteller Artikelnummer: | CSB-MP3388GND |
| Alternativnummer: | CSB-MP3388GND-1, CSB-MP3388GND-100, CSB-MP3388GND-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Non-structural protein 9,CSB-PR2024 |
| Molekulargewicht: | 44.5 kDa |
| Tag: | C-terminal hFc-Flag-tagged |
| UniProt: | P0DTD1 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 1-113aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
Produktgarantie und fachkundiger Support
