Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)

Artikelnummer: CSB-MP3388GND
Artikelname: Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)
Artikelnummer: CSB-MP3388GND
Hersteller Artikelnummer: CSB-MP3388GND
Alternativnummer: CSB-MP3388GND-1, CSB-MP3388GND-100, CSB-MP3388GND-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Non-structural protein 9,CSB-PR2024
Molekulargewicht: 44.5 kDa
Tag: C-terminal hFc-Flag-tagged
UniProt: P0DTD1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 1-113aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ