Recombinant Human betacoronavirus 2c EMC/2012 Spike glycoprotein (S), partial

Produktübersicht

• Artikelname: Recombinant Human betacoronavirus 2c EMC/2012 Spike glycoprotein (S), partial
• Artikelnummer: CSB-MP3416GNJH8
• Hersteller Artikelnummer: CSB-MP3416GNJh8
• Alternativnummer: CSB-MP3416GNJH8-1, CSB-MP3416GNJH8-100, CSB-MP3416GNJH8-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: E2 Peplomer protein

Produkteigenschaften

• Molekulargewicht: 55.6 kDa
• Tag: C-terminal mFc-tagged
• UniProt: K0BRG7
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 367-606aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY