Recombinant Human Urokinase-type plasminogen activator(PLAU) (Active)

Produktübersicht

• Artikelname: Recombinant Human Urokinase-type plasminogen activator(PLAU) (Active)
• Artikelnummer: CSB-MP360437HU
• Hersteller Artikelnummer: CSB-MP360437HU
• Alternativnummer: CSB-MP360437HU-1, CSB-MP360437HU-100, CSB-MP360437HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 47.9 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: P00749
• Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Mammalian cell
• Expression System: 21-431aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHN

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration