Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E

Produktübersicht

• Artikelname: Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E
• Artikelnummer: CSB-MP360607DBI
• Hersteller Artikelnummer: CSB-MP360607DBI
• Alternativnummer: CSB-MP360607DBI-1, CSB-MP360607DBI-100, CSB-MP360607DBI-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (DTX-E)(Venom basic protease inhibitor E),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 35.5 kDa
• Tag: C-terminal hFc-tagged
• UniProt: P00984
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 1-59aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG