Recombinant Bovine Odorant-binding protein
Artikelnummer:
CSB-MP362133BO
- Bilder (0)
| Artikelname: | Recombinant Bovine Odorant-binding protein |
| Artikelnummer: | CSB-MP362133BO |
| Hersteller Artikelnummer: | CSB-MP362133BO |
| Alternativnummer: | CSB-MP362133BO-1, CSB-MP362133BO-100, CSB-MP362133BO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Olfactory mucosa pyrazine-binding protein |
| Molekulargewicht: | 22 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P07435 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 1-159aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE |
Produktgarantie und fachkundiger Support
