Recombinant Danio rerio Fin bud initiation factor (fibin)

Produktübersicht

• Artikelname: Recombinant Danio rerio Fin bud initiation factor (fibin)
• Artikelnummer: CSB-MP375517DIL
• Hersteller Artikelnummer: CSB-MP375517DIL
• Alternativnummer: CSB-MP375517DIL-1, CSB-MP375517DIL-100, CSB-MP375517DIL-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 26.9 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: A1IGX5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 24-210aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV