Recombinant Rabbit T cell immunoreceptor with Ig and ITIM domains (TIGIT), partial

Produktübersicht

• Artikelname: Recombinant Rabbit T cell immunoreceptor with Ig and ITIM domains (TIGIT), partial
• Artikelnummer: CSB-MP5047RB
• Hersteller Artikelnummer: CSB-MP5047RB
• Alternativnummer: CSB-MP5047RB-1, CSB-MP5047RB-100, CSB-MP5047RB-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 42.7 kDa
• Tag: C-terminal hFc-tagged
• UniProt: G1SLC1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 16-142aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: APLLASGTMASMIVTTGNISAEEGGSAILQCHLSSTTTEVTQVNWEQQDRLLAVRHVDLGWHISPAFKERVVPGPSLSLTLLALTVNDTGEYFCTYHTYPDGIYKGRIFLEVRGSSVAEHSIGFQIP