Recombinant Camelpox virus Protein OPG161 (CMP150R), partial

Produktübersicht

• Artikelname: Recombinant Camelpox virus Protein OPG161 (CMP150R), partial
• Artikelnummer: CSB-MP5080CBR
• Hersteller Artikelnummer: CSB-MP5080CBR
• Alternativnummer: CSB-MP5080CBR-1, CSB-MP5080CBR-100, CSB-MP5080CBR-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 15.7 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: Q775P5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 58-184aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RLNQCMSANEAVITDATAVAVASSTHRKVASSTTQYKHKESCNGLYYQGSCYIFHSDYQLFSDAKANCTTESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN