Recombinant Cowpox virus 14 kDa protein (A27L)
Artikelnummer:
CSB-MP5087CRF
- Bilder (0)
| Artikelname: | Recombinant Cowpox virus 14 kDa protein (A27L) |
| Artikelnummer: | CSB-MP5087CRF |
| Hersteller Artikelnummer: | CSB-MP5087CRF |
| Alternativnummer: | CSB-MP5087CRF-1, CSB-MP5087CRF-100, CSB-MP5087CRF-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 14 kDa protein,14K membrane protein,14kDa fusion protein ,CPXV162 protein ,IMV membrane protein |
| Molekulargewicht: | 14.4 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q66272 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 1-110aa |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKAEGDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
Produktgarantie und fachkundiger Support
