Recombinant Cowpox virus Protein OPG161, partial

Produktübersicht

• Artikelname: Recombinant Cowpox virus Protein OPG161, partial
• Artikelnummer: CSB-MP5089CRF
• Hersteller Artikelnummer: CSB-MP5089CRF
• Alternativnummer: CSB-MP5089CRF-1, CSB-MP5089CRF-100, CSB-MP5089CRF-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 15.6 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: G0XSP8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 58-185aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN